PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011764t1
Common NameTCM_011764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32779.7 Da    PI: 5.4522
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011764t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.5e-1880133356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Thecc1EG011764t1  80 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 133
                       456899***********************************************9 PP

2HD-ZIP_I/II131.33.6e-4279171193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+y+a+k++n++L++++++L+ee+++
  Thecc1EG011764t1  79 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYEAIKADNDALQAQNQKLHEEIMA 171
                       69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-1970137IPR009057Homeodomain-like
PROSITE profilePS5007117.32975135IPR001356Homeobox domain
SMARTSM003891.8E-1778139IPR001356Homeobox domain
PfamPF000462.9E-1580133IPR001356Homeobox domain
CDDcd000861.91E-1580136No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1982142IPR009057Homeodomain-like
PRINTSPR000311.1E-5106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5115131IPR000047Helix-turn-helix motif
PfamPF021834.0E-16135175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSCNGMAFFQ ANFMLQTPHE EDHQPPSSIN QLLPSCTPQD FHGVASFLGK RSMSFSGIDV  60
CEEANGEDDL SDDGSQAGEK KRRLNMEQVK TLEKNFELGN KLEPERKMQL ARALGLQPRQ  120
IAIWFQNRRA RWKTKQLEKD YDLLKRQYEA IKADNDALQA QNQKLHEEIM ALKSREPTES  180
INLNKETEGS CSNRSENSSD IKLDISRTPA IDSPLSTHPT SRTLFPTSVR PTGTVAQLFQ  240
NASSRPDLQP QKMDQIQMVK EESLSNMFCT IEDQTGFWPW LEQQHFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046168.10.0HD domain class transcription factor
SwissprotQ8LC031e-121ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A061EAH50.0A0A061EAH5_THECC; HD domain class transcription factor
STRINGVIT_01s0026g01950.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-123HD-ZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]